ASXL2 Antibody - middle region : Biotin

ASXL2 Antibody - middle region : Biotin
SKU
AVIARP57184_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax (see MIM 159555) and polycomb (see MIM 610231) (ETP) gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing (Katoh and Katoh, 2003 [PubMed 12888926]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ASXL2

Molecular Weight: 154kDa

Peptide Sequence: Synthetic peptide located within the following region: EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative Polycomb group protein ASXL2

Protein Size: 1435

Purification: Affinity Purified
More Information
SKU AVIARP57184_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57184_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55252
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×