ATG10 Antibody - C-terminal region : HRP

ATG10 Antibody - C-terminal region : HRP
SKU
AVIARP59065_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12-ATG5 conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A), a homolog of yeast Apg8, to a membrane-bound form.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATG10

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: FFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin-like-conjugating enzyme ATG10

Protein Size: 220

Purification: Affinity Purified
More Information
SKU AVIARP59065_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59065_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 83734
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×