ATG4A Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Transcript variants that encode distinct isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG4A

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: AVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSDELIFLD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cysteine protease ATG4A

Protein Size: 259

Purification: Affinity Purified

• SKU: AVIARP58927_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58927_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 115201
• Host: Rabbit