ATP6V1A Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1A

Key Reference: Lu,M., (2007) J. Biol. Chem. 282 (34), 24495-24503

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: V-type proton ATPase catalytic subunit A

Protein Size: 617

Purification: Affinity Purified

Subunit: A

• SKU: AVIARP56324_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56324_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 523
• Host: Rabbit