ATPAF1 Antibody - middle region : FITC

ATPAF1 Antibody - middle region : FITC
SKU
AVIARP57652_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATPAF1

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ATP synthase mitochondrial F1 complex assembly factor 1

Protein Size: 328

Purification: Affinity Purified
More Information
SKU AVIARP57652_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57652_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64756
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×