AXUD1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein that localizes to the nucleus and expression of this gene is induced in response to elevated levels of axin. The Wnt signalling pathway, which is negatively regulated by axin, is important in axis formation in early development and impaired regulation of this signalling pathway is often involved in tumors. A decreased level of expression of this gene in tumors compared to the level of expression in their corresponding normal tissues suggests that this gene product has a tumor suppressor function.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AXUD1

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 589

Purification: Affinity Purified

• SKU: AVIARP57693_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57693_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64651
• Host: Rabbit