B2M Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fib

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human B2M

Key Reference: Platt,G.W., (2008) J. Mol. Biol. 378 (1), 251-263

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beta-2-microglobulin

Protein Size: 119

Purification: Affinity Purified

• SKU: AVIARP56555_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56555_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 567
• Host: Rabbit