Bbs1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: PCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Bbs1 Ensembl ENSMUSP00000055321

Protein Size: 593

Purification: Affinity Purified

• SKU: AVIARP57663_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57663_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 52028
• Host: Rabbit