BCKDHA Antibody - N-terminal region : FITC

BCKDHA Antibody - N-terminal region : FITC
SKU
AVIARP56119_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).The BCKDHA gene encodes the E1-alpha subunit of the branched-chain alpha-keto acid (BCAA) dehydrogenase complex (BCKD; EC 1.2.4.4), an inner-mitochondrial enzyme complex that catalyzes the oxidative decarboxylation of the branched-chain alpha-ketoacids derived from isoleucine, leucine, and valine. This reaction is the second major step in the catabolism of the branched-chain amino acids (Wynn et al., 1998 [PubMed 9582350]). The BCKD complex consists of 3 catalytic components: a heterotetrameric (alpha2-beta2) branched-chain alpha-keto acid decarboxylase (E1), a homo-24-meric dihydrolipoyl transacylase (E2; MIM 248610), and a homodimeric dihydrolipoamide dehydrogenase (E3; MIM 238331). E1 is a thiamine pyrophosphate (TPP)-dependent enzyme. The reaction is irreversible and constitutes the first committed step in BCAA oxidation. The BCKDHB gene (MIM 248611) encodes the beta subunit of E1. The complex also contains 2 regulatory enzymes, a kinase and a phosphorylase.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-675 BI910860.1 12-686 676-1196 BG742673.1 80-600 1197-1731 BM702667.1 48-582 1732-1763 BE223026.1 1-32 c 1764-1781 BQ018849.1 1-18 c

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BCKDHA

Key Reference: Flaschker,N., (2007) J. Inherit. Metab. Dis. 30 (6), 903-909

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial

Protein Size: 445

Purification: Affinity Purified

Subunit: alpha, mitochondrial
More Information
SKU AVIARP56119_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56119_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 593
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×