BET1 Antibody - N-terminal region

Description of Target: This gene encodes a golgi-associated membrane protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex. The encoded protein functions as a soluble N-ethylaleimide-sensitive factor attachment protein receptor and may be involved in the docking of ER-derived vesicles with the cis-Golgi membrane. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BET1

Molecular Weight: 12 kDa

Peptide Sequence: Synthetic peptide located within the following region: PPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: BET1 homolog

Protein Size: 118

Purification: Affinity purified

• SKU: AVIARP82328_P050-25
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP82328_P050-25UL
• Package Unit: 25µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10282
• Host: Rabbit
• Conjugate: Unconjugated