BIVM Antibody - middle region : Biotin

BIVM Antibody - middle region : Biotin
SKU
AVIARP57009_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BIVM

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: LYKPHGKNKTAGETASGALSKLTRGLKDESLAYIYHCQNHYFCPIGFEAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Basic immunoglobulin-like variable motif-containing protein

Protein Size: 503

Purification: Affinity Purified
More Information
SKU AVIARP57009_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57009_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54841
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×