BLMH Antibody - middle region : FITC

BLMH Antibody - middle region : FITC
SKU
AVIARP56106_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BLMH

Key Reference: de (2008) J. Clin. Oncol. 26 (11), 1817-1823

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Bleomycin hydrolase

Protein Size: 455

Purification: Affinity Purified
More Information
SKU AVIARP56106_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56106_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 642
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×