Bloc1s2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Bloc1s2 may play a role in cell proliferation. The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. It plays a role in intracellular vesicle trafficking.

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Biogenesis of lysosome-related organelles complex 1 subunit 2

Protein Size: 143

Purification: Affinity Purified

Subunit: 2

• SKU: AVIARP55703_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55703_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 73689
• Host: Rabbit