Bloc1s2 Antibody - N-terminal region : FITC

Bloc1s2 Antibody - N-terminal region : FITC
SKU
AVIARP55703_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Bloc1s2 may play a role in cell proliferation. The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. It plays a role in intracellular vesicle trafficking.

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Biogenesis of lysosome-related organelles complex 1 subunit 2

Protein Size: 143

Purification: Affinity Purified

Subunit: 2
More Information
SKU AVIARP55703_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55703_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 73689
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×