BLVRB Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BLVRB

Key Reference: Smith,L.J., (2008) Biochem. J. 411 (3), 475-484

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Flavin reductase (NADPH)

Protein Size: 206

Purification: Affinity Purified

• SKU: AVIARP56121_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56121_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 645
• Host: Rabbit