BLVRB Antibody - middle region : HRP

BLVRB Antibody - middle region : HRP
SKU
AVIARP56121_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BLVRB

Key Reference: Smith,L.J., (2008) Biochem. J. 411 (3), 475-484

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Flavin reductase (NADPH)

Protein Size: 206

Purification: Affinity Purified
More Information
SKU AVIARP56121_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56121_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 645
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×