Bnip3l Antibody - middle region : Biotin

Bnip3l Antibody - middle region : Biotin
SKU
AVIARP58878_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Bnip3l induces apoptosis. It interacts with viral and cellular anti-apoptosis proteins. It can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. It inhibits apoptosis induced by BNIP3. It is involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates to mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. Bnip3l may function as a tumor suppressor.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: CDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like

Protein Size: 218

Purification: Affinity Purified
More Information
SKU AVIARP58878_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58878_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 12177
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×