BUB3 Antibody - N-terminal region : HRP

BUB3 Antibody - N-terminal region : HRP
SKU
AVIARP58599_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: BUB3 is required for kinetochore localization of BUB1.This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BUB3

Key Reference: Vaclavicek,A., (2007) Breast Cancer Res. Treat. 106 (2), 205-213

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitotic checkpoint protein BUB3

Protein Size: 326

Purification: Affinity Purified
More Information
SKU AVIARP58599_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58599_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Immunofluorescence, Western Blotting, Immunohistochemistry
Human Gene ID 9184
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×