C10orf55 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C10orf55

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: DTHMELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPIPKPTLPSPSRL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C10orf55

Protein Size: 151

Purification: Affinity Purified

• SKU: AVIARP56143_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56143_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 414236
• Host: Rabbit