C10orf56 Antibody - middle region : Biotin

C10orf56 Antibody - middle region : Biotin
SKU
AVIARP55587_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of C10orf56 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C10orf56

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger CCHC domain-containing protein 24

Protein Size: 241

Purification: Affinity Purified
More Information
SKU AVIARP55587_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55587_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 219654
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×