C11orf53 Antibody - middle region : Biotin

C11orf53 Antibody - middle region : Biotin
SKU
AVIARP55885_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf53

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C11orf53

Protein Size: 236

Purification: Affinity Purified
More Information
SKU AVIARP55885_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55885_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 341032
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×