C11orf67 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C11orf67 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf67

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mth938 domain-containing protein

Protein Size: 122

Purification: Affinity Purified

• SKU: AVIARP55391_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55391_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 28971
• Host: Rabbit