C11orf77 Antibody - middle region : Biotin

C11orf77 Antibody - middle region : Biotin
SKU
AVIARP55708_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf77

Key Reference: Sinzelle,L., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (12), 4715-4720

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative nuclease HARBI1

Protein Size: 349

Purification: Affinity Purified
More Information
SKU AVIARP55708_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55708_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283254
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×