C12orf24 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The exact function of C12orf24 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf24

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM216A

Protein Size: 273

Purification: Affinity Purified

• SKU: AVIARP54929_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54929_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 29902
• Host: Rabbit