C12orf40 Antibody - N-terminal region : Biotin

C12orf40 Antibody - N-terminal region : Biotin
SKU
AVIARP54472_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of C12orf40 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf40

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C12orf40

Protein Size: 652

Purification: Affinity Purified
More Information
SKU AVIARP54472_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54472_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283461
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×