C12orf42 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C12orf42 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf42

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C12orf42

Protein Size: 360

Purification: Affinity Purified

• SKU: AVIARP54542_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54542_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 374470
• Host: Rabbit