C16orf65 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C16orf65

Key Reference: Martin,J., (2004) Nature 432 (7020), 988-994

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: PDZ domain-containing protein 9

Protein Size: 202

Purification: Affinity Purified

• SKU: AVIARP55697_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55697_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 255762
• Host: Rabbit