C17orf78 Antibody - middle region : Biotin

C17orf78 Antibody - middle region : Biotin
SKU
AVIARP55673_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of the protein encoded by this gene is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C17orf78

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C17orf78

Protein Size: 275

Purification: Affinity Purified
More Information
SKU AVIARP55673_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55673_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 284099
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×