C17orf97 Antibody - N-terminal region : HRP

C17orf97 Antibody - N-terminal region : HRP
SKU
AVIARP54431_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of LOC400566 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC400566

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: VSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C17orf97

Protein Size: 433

Purification: Affinity Purified
More Information
SKU AVIARP54431_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54431_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 400566
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×