C18orf10 Antibody - middle region : FITC

C18orf10 Antibody - middle region : FITC
SKU
AVIARP55267_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of C18orf10 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C18orf10

Key Reference: Petroziello,J., (2004) Oncogene 23 (46), 7734-7745

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: LYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPIT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin polyglutamylase complex subunit 2

Protein Size: 300

Purification: Affinity Purified

Subunit: 2
More Information
SKU AVIARP55267_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55267_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25941
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×