C18orf32 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C18orf32

Key Reference: Matsuda,A., (2003) Oncogene 22 (21), 3307-3318

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: UPF0729 protein C18orf32

Protein Size: 76

Purification: Affinity Purified

• SKU: AVIARP56250_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56250_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 497661
• Host: Rabbit