C1orf104 Antibody - middle region : Biotin

C1orf104 Antibody - middle region : Biotin
SKU
AVIARP54499_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf104

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative uncharacterized protein RUSC1-AS1

Protein Size: 236

Purification: Affinity Purified
More Information
SKU AVIARP54499_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54499_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 284618
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×