C1orf104 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf104

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative uncharacterized protein RUSC1-AS1

Protein Size: 236

Purification: Affinity Purified

• SKU: AVIARP54499_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54499_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 284618
• Host: Rabbit