C1orf144 Antibody - N-terminal region : Biotin

C1orf144 Antibody - N-terminal region : Biotin
SKU
AVIARP55304_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf144

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SUZ domain-containing protein 1

Protein Size: 133

Purification: Affinity Purified
More Information
SKU AVIARP55304_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55304_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 26099
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×