C1orf190 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf190

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine rich adaptor protein 1

Protein Size: 239

Purification: Affinity Purified

• SKU: AVIARP56202_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56202_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 541468
• Host: Rabbit