C20orf111 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf111

Key Reference: Clerk,A., (2007) Physiol. Genomics 29 (2), 118-127

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C20orf111

Protein Size: 292

Purification: Affinity Purified

• SKU: AVIARP56915_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56915_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51526
• Host: Rabbit