C22orf28 Antibody - middle region : Biotin

C22orf28 Antibody - middle region : Biotin
SKU
AVIARP56746_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C22orf28

Key Reference: Guo,D., (2005) Biochem. Biophys. Res. Commun. 337 (4), 1308-1318

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA-splicing ligase RtcB homolog

Protein Size: 505

Purification: Affinity Purified
More Information
SKU AVIARP56746_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56746_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51493
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×