C2orf29 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf29

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0760 protein C2orf29

Protein Size: 510

Purification: Affinity Purified

• SKU: AVIARP56972_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56972_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55571
• Host: Rabbit