C2orf29 Antibody - N-terminal region : Biotin

C2orf29 Antibody - N-terminal region : Biotin
SKU
AVIARP56971_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf29

Key Reference: 0

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0760 protein C2orf29

Protein Size: 510

Purification: Affinity Purified
More Information
SKU AVIARP56971_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56971_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55571
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×