C2orf55 Antibody - middle region : HRP

C2orf55 Antibody - middle region : HRP
SKU
AVIARP56003_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf55

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein KIAA1211-like

Protein Size: 962

Purification: Affinity Purified
More Information
SKU AVIARP56003_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56003_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 343990
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×