C2orf68 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The exact function of LOC388969 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC388969

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: VRRRHTPAPTRPRKPDLQVYLPRHRDVSAHPRNPDYEESGESSSSGGSEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0561 protein C2orf68

Protein Size: 166

Purification: Affinity Purified

• SKU: AVIARP54429_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54429_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 388969
• Host: Rabbit