C6orf146 Antibody - middle region : Biotin

C6orf146 Antibody - middle region : Biotin
SKU
AVIARP55647_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of C6orf146 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf146

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM217A

Protein Size: 508

Purification: Affinity Purified
More Information
SKU AVIARP55647_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55647_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 222826
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×