C6orf182 Antibody - middle region : Biotin

C6orf182 Antibody - middle region : Biotin
SKU
AVIARP55720_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact functions of C6orf182 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf182

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LNVEREKNMILEQQAQLQREKEQDQMKLYAKLEKLDVLEKECFRLTTTQK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centrosomal protein CEP57L1

Protein Size: 460

Purification: Affinity Purified
More Information
SKU AVIARP55720_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55720_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285753
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×