C6orf199 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The exact function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf199

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: IINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEVIENHRKKKKEAQK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Adenylate kinase domain-containing protein 1

Protein Size: 421

Purification: Affinity Purified

• SKU: AVIARP55457_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55457_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 221264
• Host: Rabbit