C6orf199 Antibody - N-terminal region : FITC

C6orf199 Antibody - N-terminal region : FITC
SKU
AVIARP55456_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of the C6orf199 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf199

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYIT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Adenylate kinase domain-containing protein 1

Protein Size: 421

Purification: Affinity Purified
More Information
SKU AVIARP55456_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55456_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221264
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×