C6orf199 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of the C6orf199 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf199

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYIT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Adenylate kinase domain-containing protein 1

Protein Size: 421

Purification: Affinity Purified

• SKU: AVIARP55456_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55456_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 221264
• Host: Rabbit