C7orf38 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of this protein remains unknown. The protein is weakly similar to transposase-like proteins in human and mouse.This gene encodes a protein of unknown function. The protein is weakly similar to transposase-like proteins in human and mouse.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C7orf38

Key Reference: Thompson,E.E., (2006) Pharmacogenomics J. 6 (2), 105-114

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM200A

Protein Size: 573

Purification: Affinity Purified

• SKU: AVIARP55465_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55465_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Dog (Canine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 221786
• Host: Rabbit