C9orf25 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein has not been determined.The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus. The function of this protein has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf25

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM219A

Protein Size: 168

Purification: Affinity Purified

• SKU: AVIARP55478_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55478_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 203259
• Host: Rabbit