C9orf43 Antibody - middle region : HRP

C9orf43 Antibody - middle region : HRP
SKU
AVIARP55555_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of the C9orf43 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf43

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C9orf43

Protein Size: 461

Purification: Affinity Purified
More Information
SKU AVIARP55555_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55555_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Yeast
Clonality Polyclonal
Application Western Blotting
Human Gene ID 257169
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×