C9orf68 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf68

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Spermatogenesis associated 6-like protein

Protein Size: 392

Purification: Affinity Purified

• SKU: AVIARP56259_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56259_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55064
• Host: Rabbit